Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00051125-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00051125-M01, RRID:AB_464216
- Product name
- GOLGA7 monoclonal antibody (M01), clone 2H8
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant GOLGA7.
- Antigen sequence
MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELE
NRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCL
ACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIY
APQGLLLTDPIERGLRVIEITIYEDRGMSSGR- Isotype
- IgG
- Antibody clone number
- 2H8
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Palmitoylation of oncogenic NRAS is essential for leukemogenesis.
Cuiffo B, Ren R
Blood 2010 Apr 29;115(17):3598-605
Blood 2010 Apr 29;115(17):3598-605
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- GOLGA7 monoclonal antibody (M01), clone 2H8 Western Blot analysis of GOLGA7 expression in HL-60 ( Cat # L014V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged GOLGA7 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunoprecipitation of GOLGA7 transfected lysate using anti-GOLGA7 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GOLGA7 monoclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol