HPA017736

HS3ST2 antibody from Sigma-Aldrich
3OST2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017736
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017736, RRID:AB_1851095
Product name
Anti-HS3ST2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017736
Antibody type
Polyclonal
Antigen
Heparan sulfate glucosamine 3-O-sulfotransferase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
APRCLRGPSAGGQKLLQKSRPCDPSGPTPSEPSAP
SAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVG
VKKGGTRAVLEFIRVHPDVRALGTEPHFFDRNYGR
G
Storage
-20C
Provider Type Product Number
- No reagents -