HPA017736

HS3ST2 antibody from Atlas Antibodies
3OST2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017736
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017736, RRID:AB_1851095
Product name
Anti-HS3ST2
Provider product page
Atlas Antibodies - HPA017736
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
APRCLRGPSAGGQKLLQKSRPCDPSGPTPSEPSAP
SAPAAAVPAPRLSGSNHSGSPKLGTKRLPQALIVG
VKKGGTRAVLEFIRVHPDVRALGTEPHFFDRNYGR
G
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -