Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001200-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001200-M01, RRID:AB_489715
- Product name
- TPP1 monoclonal antibody (M01), clone 3B1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TPP1.
- Antigen sequence
GLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQ
FLEQYFHDSDLAQFMRLFGGNFAHQASVARVVGQQ
GRGRAGIEASLDVQYLMSAGANISTWVYSSPGRHE
GQEPF- Isotype
- IgG
- Antibody clone number
- 3B1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Altered expression of TPP1 in fibroblast-like synovial cells might be involved in the pathogenesis of rheumatoid arthritis.
Qing YF, Zhou JG, Zhao MC, Xie WG, Yang QB, Xing Y, Zeng SP, Jiang H
Rheumatology international 2012 Aug;32(8):2503-10
Rheumatology international 2012 Aug;32(8):2503-10
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- TPP1 monoclonal antibody (M01), clone 3B1 Western Blot analysis of TPP1 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged TPP1 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to TPP1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol