Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB28621 - Provider product page
- Provider
- Abnova Corporation
- Product name
- GMFB polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant GMFB.
- Antigen sequence
SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKI
DKDKRLVVLDEELEGISPDELKDELPERQPRFIVY
SYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAG
SKN- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: Human cell line RT-4 with GMFB polyclonal antibody (Cat # PAB28621).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells), Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) with GMFB polyclonal antibody (Cat # PAB28621).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex with GMFB polyclonal antibody (Cat # PAB28621) shows strong cytoplasmic positivity in neuronal cells at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)