Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [8]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002954 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA002954, RRID:AB_1078997
- Product name
- Anti-GMFB
- Antibody type
- Polyclonal
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKI
DKDKRLVVLDEELEGISPDELKDELPERQPRFIVY
SYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAG
SKN- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references GMFβ controls branched actin content and lamellipodial retraction in fibroblasts.
Evaluation of blastomere biopsy using a mouse model indicates the potential high risk of neurodegenerative disorders in the offspring.
Haynes EM, Asokan SB, King SJ, Johnson HE, Haugh JM, Bear JE
The Journal of cell biology 2015 Jun 22;209(6):803-12
The Journal of cell biology 2015 Jun 22;209(6):803-12
Evaluation of blastomere biopsy using a mouse model indicates the potential high risk of neurodegenerative disorders in the offspring.
Yu Y, Wu J, Fan Y, Lv Z, Guo X, Zhao C, Zhou R, Zhang Z, Wang F, Xiao M, Chen L, Zhu H, Chen W, Lin M, Liu J, Zhou Z, Wang L, Huo R, Zhou Q, Sha J
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1490-500
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1490-500
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, nuclear bodies & cytosol.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse somatosensory cortex shows immunoreactivity in neuronal cell bodies and dendrites.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows neuronal positivity.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse olfactory bulb shows immunoreactivity in neurons.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse lateral septum shows positivity in a subset of neurons.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse red nucleus shows immunoreactivity in neuronal cell bodies.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescence staining of mouse cerebellum shows strong positivity in Purkinje cells.
- Sample type
- MOUSE
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows strong cytoplasmic immunoreactivity in neurons.
- Sample type
- HUMAN