HPA002954

GMFB antibody from Sigma-Aldrich
GMF
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA002954
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA002954, RRID:AB_1078997
Product name
Anti-GMFB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA002954
Antibody type
Polyclonal
Antigen
Glia maturation factor beta recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKI
DKDKRLVVLDEELEGISPDELKDELPERQPRFIVY
SYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAG
SKN
Storage
-20C
Provider Type Product Number
- No reagents -