Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA002954 - Provider product page
- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Anti-GMFB antibody produced in rabbit
- Antibody type
- Polyclonal
- Antigen
- Glia maturation factor beta recombinant protein epitope signature tag (PrEST)
- Description
- affinity isolated antibody
- Reactivity
- Human
- Antigen sequence
SESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKI
DKDKRLVVLDEELEGISPDELKDELPERQPRFIVY
SYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAG
SKN- Storage
- -20C
Submitted references Evaluation of blastomere biopsy using a mouse model indicates the potential high risk of neurodegenerative disorders in the offspring.
Yu Y, Wu J, Fan Y, Lv Z, Guo X, Zhao C, Zhou R, Zhang Z, Wang F, Xiao M, Chen L, Zhu H, Chen W, Lin M, Liu J, Zhou Z, Wang L, Huo R, Zhou Q, Sha J
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1490-500
Molecular & cellular proteomics : MCP 2009 Jul;8(7):1490-500
No comments: Submit comment
No validations: Submit validation data