HPA009025

FAM213A antibody from Sigma-Aldrich
C10orf58, MGC4248, PAMM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009025
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009025, RRID:AB_1078312
Product name
Anti-C10orf57 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009025
Antibody type
Polyclonal
Antigen
Uncharacterized protein C10orf58 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NTDVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAK
ELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSML
DQLGVPLYAVVKEHIRTEVKDFQPYFKGE
Storage
-20C
Provider Type Product Number
- No reagents -