HPA009025

PRXL2A antibody from MilliporeSigma / Merck KGaA
Adrx, C10orf58, FAM213A, MGC4248, PAMM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009025
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-C10orf57 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA009025
Antibody type
Polyclonal
Antigen
Uncharacterized protein C10orf58 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NTDVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAK
ELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSML
DQLGVPLYAVVKEHIRTEVKDFQPYFKGE
Storage
-20C