HPA024565

PRXL2A antibody from Atlas Antibodies
Adrx, C10orf58, FAM213A, MGC4248, PAMM
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA024565
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA024565, RRID:AB_1845519
Product name
Anti-FAM213A
Provider product page
Atlas Antibodies - HPA024565
Antibody type
Polyclonal
Reactivity
Human, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGN
LEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVN
LLSVLEAAKMIKPQTLASEK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -