PAB21714

PRXL2A antibody from Abnova Corporation
Adrx, C10orf58, FAM213A, MGC4248, PAMM

Antibody data

Product number
PAB21714
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB21714, RRID:AB_10966227
Product name
FAM213A polyclonal antibody
Provider product page
Abnova Corporation - PAB21714
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant FAM213A.
Antigen sequence
KFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGN
LEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVN
LLSVLEAAKMIKPQTLASEK
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -