Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA009025 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA009025, RRID:AB_1078312
- Product name
- Anti-FAM213A
- Antibody type
- Polyclonal
- Reactivity
- Human, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NTDVFLSKPQKAALEYLEDIDLKTLEKEPRTFKAK
ELWEKNGAVIMAVRRPGCFLCREEAADLSSLKSML
DQLGVPLYAVVKEHIRTEVKDFQPYFKGE- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A short report: PAMM, a novel antioxidant protein, induced by oxidative stress.
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
PAMM: a redox regulatory protein that modulates osteoclast differentiation.
Xu Y, Morse LR, da Silva RAB, Wang D, Battaglino RA
Redox biology 2015 Dec;6:446-453
Redox biology 2015 Dec;6:446-453
Systematic validation of antibody binding and protein subcellular localization using siRNA and confocal microscopy
Stadler C, Hjelmare M, Neumann B, Jonasson K, Pepperkok R, Uhlén M, Lundberg E
Journal of Proteomics 2012 April;75(7):2236-2251
Journal of Proteomics 2012 April;75(7):2236-2251
PAMM: a redox regulatory protein that modulates osteoclast differentiation.
Xu Y, Morse LR, da Silva RA, Odgren PR, Sasaki H, Stashenko P, Battaglino RA
Antioxidants & redox signaling 2010 Jul 1;13(1):27-37
Antioxidants & redox signaling 2010 Jul 1;13(1):27-37
No comments: Submit comment
Enhanced validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Western blot analysis in human cell lines SK-MEL-30 and PC-3 using Anti-FAM213A antibody. Corresponding FAM213A RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human breast shows strong cytoplasmic positivity in adipocytes.
- Sample type
- HUMAN