H00051605-B01

TRMT6 antibody from Abnova Corporation
CGI-09, GCD10, Gcd10p, MGC5029

Antibody data

Product number
H00051605-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051605-B01, RRID:AB_1138020
Product name
CGI-09 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00051605-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CGI-09 protein.
Antigen sequence
MEGSGEQPGPQPQHPGDHRIRDGDFVVLKREDVFK
AVQVQRRKKVTFEKQWFYLDNVIGHSYGTAFEVTS
GGSLQPKKKREEPTAETKEAGTDNRNIVDDGKSQK
LTQDDIKALKDKGIKGEEIVQQLIENSTTFRDKTE
FAQDKYIKKKKKKYEAIITVVKPSTRILSIMYYAR
EPGKINHMRYDTLAQMLTLGNIRAGNKMIVMETCA
GLVLGAMMERMGGFGSIIQLYPGGGPVRAATACFG
FPKSFLSGLYEFPLNKVDSLLHGTFSAKMLSSEPK
DSALVEESNGTLEEKQASEQENEDSMAEAPESNHP
EDQETMETISQDPEHKGPKERGSKKDYIQEKQRRQ
EEQRKRHLEAAALLSERNADGLIVASRFHPTPLLL
SLLDFVAPSRPFVVYCQYKEPLLECYTKLRERGGV
INLRLSETWLRNYQVLPDRSHPKLLMSGGGGYLLS
GFTVAMDNLKADTSLKSNASTLESHETEEPAAKKR
KCPESDS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -