HPA050408

TRMT6 antibody from Atlas Antibodies
CGI-09, GCD10, Gcd10p, MGC5029

Antibody data

Product number
HPA050408
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA050408, RRID:AB_2681117
Product name
Anti-TRMT6
Provider product page
Atlas Antibodies - HPA050408
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LKDKGIKGEEIVQQLIENSTTFRDKTEFAQDKYIK
KKKKKYEAIITVVKPSTRILSIMYYAREPGKINHM
RYDTLAQMLTLGNIRAGN
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -