HPA047032

TRMT6 antibody from Atlas Antibodies
CGI-09, GCD10, Gcd10p, MGC5029
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA047032
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA047032, RRID:AB_2679911
Product name
Anti-TRMT6
Provider product page
Atlas Antibodies - HPA047032
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KMIVMETCAGLVLGAMMERMGGFGSIIQLYPGGGP
VRAATACFGFPKSFLSGLYEFPLNKVDSLLHGTFS
AKMLSSEPKDSALVEESNGTLE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -