HPA015630

HERPUD2 antibody from Sigma-Aldrich
FLJ22313
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015630
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA015630, RRID:AB_1850609
Product name
Anti-HERPUD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA015630
Antibody type
Polyclonal
Antigen
Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQ
MYAHQYYMQYQAAVSAQATSNVNPTQPTTSQPLNL
AHVPGEEPPPAPNLVAQENRPMNENVQMNAQGGPV
LNEEDFNRDWLDWMYTFSR
Storage
-20C
Provider Type Product Number
- No reagents -