HPA015630

HERPUD2 antibody from Atlas Antibodies
FLJ22313
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015630
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015630, RRID:AB_1850609
Product name
Anti-HERPUD2
Provider product page
Atlas Antibodies - HPA015630
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VMQGNVDNQFPGQAAPPGFPVYPAFSPLQMLWWQQ
MYAHQYYMQYQAAVSAQATSNVNPTQPTTSQPLNL
AHVPGEEPPPAPNLVAQENRPMNENVQMNAQGGPV
LNEEDFNRDWLDWMYTFSR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -