H00115761-B01P

ARL11 antibody from Abnova Corporation
ARLTS1, FLJ33930

Antibody data

Product number
H00115761-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00115761-B01P, RRID:AB_1237724
Product name
ARL11 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00115761-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human ARL11 protein.
Antigen sequence
MGSVNSRGHKAEAQVVMMGLDSAGKTTLLYKLKGH
QLVETLPTVGFNVEPLKAPGHVSLTLWDVGGQAPL
RASWKDYLEGTDILVYVLDSTDEARLPESAAELTE
VLNDPNMAGVPFLVLANKQEAPDALPLLKIRNRLS
LERFQDHCWELRGCSALTGEGLPEALQSLWSLLKS
RSCMCLQARAHGAERGDSKRS
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -