SAB1400652

CLTRN antibody from Sigma-Aldrich
NX17, TMEM27
ELISA
Recommended by provider

Antibody data

Product number
SAB1400652
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400652, RRID:AB_1858114
Product name
Anti-TMEM27 antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400652
Antibody type
Polyclonal
Antigen
TMEM27 (NP_065716, a.a. 1-222) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MLWLLFFLVTAIHAELCQPGAENAFKVRLSIRTAL
GDKAYAWDTNEEYLFKAMVAFSMRKVPNREATEIS
HVLLCNVTQRVSFWFVVTDPSKNHTLPAVEVQSAI
RMNKNRINNAFFLNDQTLEFLKIPSTLAPPMDPSV
PIWIIIFGVIFCIIIVAIALLILSGIWQRRRKNKE
PSEVDDAEDKCENMITIENGIPSDPLDMKGGHIND
AFMTEDERLTPL (without GST)
Storage
-20C
Provider Type Product Number
- No reagents -