Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00000540-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00000540-M01, RRID:AB_489747
- Product name
- ATP7B monoclonal antibody (M01), clone 3E10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ATP7B.
- Antigen sequence
QLKCYKKPDLERYEAQAHGHMKPLTASQVSVHIGM
DDRWRDSPRATPWDQVSYVSQVSLSSLTSDKPSRH
SAAADDDGDKWSLLLNGRDEEQYI- Isotype
- IgG
- Antibody clone number
- 3E10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Characterization of sandwich-cultured hepatocytes as an in vitro model to assess the hepatobiliary disposition of copper.
Ansede JH, Wright MR, St Claire RL 3rd, Hart RW, Gefroh HA, Brouwer KR
Drug metabolism and disposition: the biological fate of chemicals 2009 May;37(5):969-76
Drug metabolism and disposition: the biological fate of chemicals 2009 May;37(5):969-76
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- ATP7B monoclonal antibody (M01), clone 3E10. Western Blot analysis of ATP7B expression in human colon.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ATP7B is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol