HPA013187

ATP7B antibody from Sigma-Aldrich
WND
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013187
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013187, RRID:AB_1845206
Product name
Anti-ATP7B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013187
Antibody type
Polyclonal
Antigen
Copper-transporting ATPase 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDH
VNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRP
LSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKS
CVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSC
TSPV
Storage
-20C
Provider Type Product Number
- No reagents -