HPA013187

ATP7B antibody from Atlas Antibodies
WND
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013187
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013187, RRID:AB_1233524
Product name
Anti-ATP7B
Provider product page
Atlas Antibodies - HPA013187
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RKLQGVVRVKVSLSNQEAVITYQPYLIQPEDLRDH
VNDMGFEAAIKSKVAPLSLGPIDIERLQSTNPKRP
LSSANQNFNNSETLGHQGSHVVTLQLRIDGMHCKS
CVLNIEENIGQLLGVQSIQVSLENKTAQVKYDPSC
TSPV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -