Antibody data
- Antibody Data
- Antigen structure
- References [11]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunoprecipitation [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00002643-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00002643-M01, RRID:AB_464422
- Product name
- GCH1 monoclonal antibody (M01), clone 4A12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant GCH1.
- Antigen sequence
ENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLN
DAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVH
IGYLPNKQVLGLSKLARIV- Isotype
- IgG
- Antibody clone number
- 4A12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Effect of soluble guanylyl cyclase activator and stimulator therapy on nitroglycerin-induced nitrate tolerance in rats.
Redox activation of DUSP4 by N-acetylcysteine protects endothelial cells from Cd²⁺-induced apoptosis.
Inflammatory monocytes determine endothelial nitric-oxide synthase uncoupling and nitro-oxidative stress induced by angiotensin II.
Inhibition of GTP cyclohydrolase attenuates tumor growth by reducing angiogenesis and M2-like polarization of tumor associated macrophages.
Vascular dysfunction in streptozotocin-induced experimental diabetes strictly depends on insulin deficiency.
Sepiapterin improves angiogenesis of pulmonary artery endothelial cells with in utero pulmonary hypertension by recoupling endothelial nitric oxide synthase.
Vascular dysfunction in experimental diabetes is improved by pentaerithrityl tetranitrate but not isosorbide-5-mononitrate therapy.
Differential effects of heart rate reduction with ivabradine in two models of endothelial dysfunction and oxidative stress.
Role of angiotensin II on dihydrofolate reductase, GTP-cyclohydrolase 1 and nitric oxide synthase expressions in renal ischemia-reperfusion.
Mechanisms underlying recoupling of eNOS by HMG-CoA reductase inhibition in a rat model of streptozotocin-induced diabetes mellitus.
Regulation of tetrahydrobiopterin biosynthesis by shear stress.
Jabs A, Oelze M, Mikhed Y, Stamm P, Kröller-Schön S, Welschof P, Jansen T, Hausding M, Kopp M, Steven S, Schulz E, Stasch JP, Münzel T, Daiber A
Vascular pharmacology 2015 Aug;71:181-91
Vascular pharmacology 2015 Aug;71:181-91
Redox activation of DUSP4 by N-acetylcysteine protects endothelial cells from Cd²⁺-induced apoptosis.
Barajas-Espinosa A, Basye A, Jesse E, Yan H, Quan D, Chen CA
Free radical biology & medicine 2014 Sep;74:188-99
Free radical biology & medicine 2014 Sep;74:188-99
Inflammatory monocytes determine endothelial nitric-oxide synthase uncoupling and nitro-oxidative stress induced by angiotensin II.
Kossmann S, Hu H, Steven S, Schönfelder T, Fraccarollo D, Mikhed Y, Brähler M, Knorr M, Brandt M, Karbach SH, Becker C, Oelze M, Bauersachs J, Widder J, Münzel T, Daiber A, Wenzel P
The Journal of biological chemistry 2014 Oct 3;289(40):27540-50
The Journal of biological chemistry 2014 Oct 3;289(40):27540-50
Inhibition of GTP cyclohydrolase attenuates tumor growth by reducing angiogenesis and M2-like polarization of tumor associated macrophages.
Pickert G, Lim HY, Weigert A, Häussler A, Myrczek T, Waldner M, Labocha S, Ferreirós N, Geisslinger G, Lötsch J, Becker C, Brüne B, Tegeder I
International journal of cancer 2013 Feb 1;132(3):591-604
International journal of cancer 2013 Feb 1;132(3):591-604
Vascular dysfunction in streptozotocin-induced experimental diabetes strictly depends on insulin deficiency.
Oelze M, Knorr M, Schuhmacher S, Heeren T, Otto C, Schulz E, Reifenberg K, Wenzel P, Münzel T, Daiber A
Journal of vascular research 2011;48(4):275-84
Journal of vascular research 2011;48(4):275-84
Sepiapterin improves angiogenesis of pulmonary artery endothelial cells with in utero pulmonary hypertension by recoupling endothelial nitric oxide synthase.
Teng RJ, Du J, Xu H, Bakhutashvili I, Eis A, Shi Y, Pritchard KA Jr, Konduri GG
American journal of physiology. Lung cellular and molecular physiology 2011 Sep;301(3):L334-45
American journal of physiology. Lung cellular and molecular physiology 2011 Sep;301(3):L334-45
Vascular dysfunction in experimental diabetes is improved by pentaerithrityl tetranitrate but not isosorbide-5-mononitrate therapy.
Schuhmacher S, Oelze M, Bollmann F, Kleinert H, Otto C, Heeren T, Steven S, Hausding M, Knorr M, Pautz A, Reifenberg K, Schulz E, Gori T, Wenzel P, Münzel T, Daiber A
Diabetes 2011 Oct;60(10):2608-16
Diabetes 2011 Oct;60(10):2608-16
Differential effects of heart rate reduction with ivabradine in two models of endothelial dysfunction and oxidative stress.
Kröller-Schön S, Schulz E, Wenzel P, Kleschyov AL, Hortmann M, Torzewski M, Oelze M, Renné T, Daiber A, Münzel T
Basic research in cardiology 2011 Nov;106(6):1147-58
Basic research in cardiology 2011 Nov;106(6):1147-58
Role of angiotensin II on dihydrofolate reductase, GTP-cyclohydrolase 1 and nitric oxide synthase expressions in renal ischemia-reperfusion.
Seujange Y, Eiam-Ong S, Tirawatnapong T, Eiam-Ong S
American journal of nephrology 2008;28(4):692-700
American journal of nephrology 2008;28(4):692-700
Mechanisms underlying recoupling of eNOS by HMG-CoA reductase inhibition in a rat model of streptozotocin-induced diabetes mellitus.
Wenzel P, Daiber A, Oelze M, Brandt M, Closs E, Xu J, Thum T, Bauersachs J, Ertl G, Zou MH, Förstermann U, Münzel T
Atherosclerosis 2008 May;198(1):65-76
Atherosclerosis 2008 May;198(1):65-76
Regulation of tetrahydrobiopterin biosynthesis by shear stress.
Widder JD, Chen W, Li L, Dikalov S, Thöny B, Hatakeyama K, Harrison DG
Circulation research 2007 Oct 12;101(8):830-8
Circulation research 2007 Oct 12;101(8):830-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- GCH1 monoclonal antibody (M01), clone 4A12 Western Blot analysis of GCH1 expression in IMR-32 ( Cat # L008V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of GCH1 expression in transfected 293T cell line by GCH1 monoclonal antibody (M01), clone 4A12.Lane 1: GCH1 transfected lysate(27.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged GCH1 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of GCH1 transfected lysate using anti-GCH1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GCH1 MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to GCH1 on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol