ABIN786038

GCH1 antibody from antibodies-online
DYT14, DYT5, DYT5a, GCH, GTPCH1

Antibody data

Product number
ABIN786038
Provider
antibodies-online
Product name
anti-GTP Cyclohydrolase 1 (GCH1) (C-Term) antibody
Provider product page
antibodies-online - ABIN786038
Antibody type
Polyclonal
Antigen
The immunogen for anti-GCH1 antibody: synthetic peptide directed towards the C terminal of human GCH1
Reactivity
Human
Host
Rabbit
Antigen sequence
LRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTML
GVFRE DPKTREEFLT
Vial size
50 µg
Provider Type Product Number
- No reagents -