Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001645-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001645-A01, RRID:AB_462454
- Product name
- AKR1C1 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant AKR1C1.
- Antigen sequence
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKAL
EATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIA
DGSVKREDIFYTSKLWCNSHRPELVRPALERSLKN
LQLDY- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Cisplatin resistance in human cervical, ovarian and lung cancer cells.
Molecular effectors and modulators of hypericin-mediated cell death in bladder cancer cells.
Chen J, Solomides C, Parekh H, Simpkins F, Simpkins H
Cancer chemotherapy and pharmacology 2015 Jun;75(6):1217-27
Cancer chemotherapy and pharmacology 2015 Jun;75(6):1217-27
Molecular effectors and modulators of hypericin-mediated cell death in bladder cancer cells.
Buytaert E, Matroule JY, Durinck S, Close P, Kocanova S, Vandenheede JR, de Witte PA, Piette J, Agostinis P
Oncogene 2008 Mar 20;27(13):1916-29
Oncogene 2008 Mar 20;27(13):1916-29
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- AKR1C1 polyclonal antibody (A01), Lot # 070510JCS1 Western Blot analysis of AKR1C1 expression in HeLa ( Cat # L013V1 ).