Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001645-B01P - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001645-B01P, RRID:AB_1571048
- Product name
- AKR1C1 purified MaxPab mouse polyclonal antibody (B01P)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a full-length human AKR1C1 protein.
- Antigen sequence
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKAL
EATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIA
DGSVKREDIFYTSKLWCNSHRPELVRPALERSLKN
LQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFD
TVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEM
ILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKD
IVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALA
KKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN
VQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPP
NYPFSDEY- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The sensitivity of cancer cells to pheophorbide a-based photodynamic therapy is enhanced by Nrf2 silencing.
An endogenous inhibitor of angiogenesis inversely correlates with side population phenotype and function in human lung cancer cells.
Proteasome inhibitors MG-132 and bortezomib induce AKR1C1, AKR1C3, AKR1B1, and AKR1B10 in human colon cancer cell lines SW-480 and HT-29.
Choi BH, Ryoo IG, Kang HC, Kwak MK
PloS one 2014;9(9):e107158
PloS one 2014;9(9):e107158
An endogenous inhibitor of angiogenesis inversely correlates with side population phenotype and function in human lung cancer cells.
Han H, Bourboulia D, Jensen-Taubman S, Isaac B, Wei B, Stetler-Stevenson WG
Oncogene 2014 Feb 27;33(9):1198-206
Oncogene 2014 Feb 27;33(9):1198-206
Proteasome inhibitors MG-132 and bortezomib induce AKR1C1, AKR1C3, AKR1B1, and AKR1B10 in human colon cancer cell lines SW-480 and HT-29.
Ebert B, Kisiela M, Wsól V, Maser E
Chemico-biological interactions 2011 May 30;191(1-3):239-49
Chemico-biological interactions 2011 May 30;191(1-3):239-49
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of AKR1C1 expression in transfected 293T cell line (H00001645-T01) by AKR1C1 MaxPab polyclonal antibody.Lane 1: AKR1C1 transfected lysate(35.53 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- AKR1C1 MaxPab polyclonal antibody. Western Blot analysis of AKR1C1 expression in human liver.