Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00050486-D01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00050486-D01, RRID:AB_10630840
- Product name
- G0S2 MaxPab rabbit polyclonal antibody (D01)
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against a full-length human G0S2 protein.
- Antigen sequence
METVQELIPLAKEMMAQKRKGKMVKLYVLGSVLAL
FGVVLGLMETVCSPFTAARRLRDQEAAVAELQAAL
ERQALQKQALQEKGKQQDTVLGGRALSNRQHAS- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of G0S2 expression in transfected 293T cell line (H00050486-T02) by G0S2 MaxPab polyclonal antibody.Lane 1: G0S2 transfected lysate(11.44 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- G0S2 MaxPab rabbit polyclonal antibody. Western Blot analysis of G0S2 expression in IMR-32.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of G0S2 transfected lysate using anti-G0S2 MaxPab rabbit polyclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with G0S2 MaxPab rabbit polyclonal antibody (D01) (H00050486-D01).
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol