Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA010016 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-G0S2
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
PFTAARRLRDQEAAVAELQAALERQALQKQALQEK
GKQQDTVLGGRALSNRQHA- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Contraction‐induced lipolysis is not impaired by inhibition of hormone‐sensitive lipase in skeletal muscle
Alsted T, Ploug T, Prats C, Serup A, Høeg L, Schjerling P, Holm C, Zimmermann R, Fledelius C, Galbo H, Kiens B
The Journal of Physiology 2013;591(20):5141-5155
The Journal of Physiology 2013;591(20):5141-5155
No comments: Submit comment
No validations: Submit validation data