HPA010016

G0S2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010016
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010016, RRID:AB_1078924
Product name
Anti-G0S2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010016
Antibody type
Polyclonal
Antigen
Putative lymphocyte G0/G1 switch protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PFTAARRLRDQEAAVAELQAALERQALQKQALQEK
GKQQDTVLGGRALSNRQHA
Storage
-20C
Provider Type Product Number
- No reagents -