Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN405874 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Dullard Homolog (Xenopus Laevis) (DULLARD) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-DULLARD antibody: synthetic peptide directed towards the middle region of human DULLARD
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTAD
VRSVL SRNLHQHRLW- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references A conserved phosphatase cascade that regulates nuclear membrane biogenesis.
Kim Y, Gentry MS, Harris TE, Wiley SE, Lawrence JC Jr, Dixon JE
Proceedings of the National Academy of Sciences of the United States of America 2007 Apr 17;104(16):6596-601
Proceedings of the National Academy of Sciences of the United States of America 2007 Apr 17;104(16):6596-601
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting