HPA037439

CTDNEP1 antibody from MilliporeSigma / Merck KGaA
DULLARD, HSA011916, NET56
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA037439
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA037439, RRID:AB_10601264
Product name
Anti-DULLARD antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA037439
Antibody type
Polyclonal
Antigen
dullard homolog (Xenopus laevis) recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPI
KSWFSDPSDTALLNLLPMLDALRFTADVRSVLS
Storage
-20C
Provider Type Product Number
- No reagents -