SAB2100632

CTDNEP1 antibody from MilliporeSigma / Merck KGaA
DULLARD, HSA011916, NET56
No application information provided.

Antibody data

Product number
SAB2100632
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-DULLARD antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - SAB2100632
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_056158.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
HPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTAD
VRSVLSRNLHQHRLW
Storage
-20C