Antibody data

Product number
H00009217-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009217-M10, RRID:AB_1205163
Product name
VAPB monoclonal antibody (M10), clone 1A2
Provider product page
Abnova Corporation - H00009217-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant VAPB.
Antigen sequence
ELPAENDKPHDVEINKIISTTASKTETPIVSKSLS
SSLDDTEVKKVMEECKRLQGEVQRLREENKQFKEE
DGLRMRKTVQSNSPISALAPTGKEEGLSTR
Isotype
IgG
Antibody clone number
1A2
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -