HPA013144

VAPB antibody from Sigma-Aldrich
ALS8, VAP-B, VAP-C
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013144
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013144, RRID:AB_1858717
Product name
Anti-VAPB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013144
Antibody type
Polyclonal
Antigen
Vesicle-associated membrane protein-associated protein B/C recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINK
IISTTASKTETPIVSKSLSSSLDDTEVKKVMEECK
RLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPIS
ALAPTGK
Storage
-20C
Provider Type Product Number
- No reagents -