HPA013144

VAPB antibody from Atlas Antibodies
ALS8, VAP-B, VAP-C
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013144
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013144, RRID:AB_1858717
Product name
Anti-VAPB
Provider product page
Atlas Antibodies - HPA013144
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
VWKEAKPEDLMDSKLRCVFELPAENDKPHDVEINK
IISTTASKTETPIVSKSLSSSLDDTEVKKVMEECK
RLQGEVQRLREENKQFKEEDGLRMRKTVQSNSPIS
ALAPTGK
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -