HPA014193

PTGIS antibody from Sigma-Aldrich
CYP8A1, PGIS
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014193
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014193, RRID:AB_1855746
Product name
Anti-PTGIS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014193
Antibody type
Polyclonal
Antigen
Prostacyclin synthase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LTLYGIEALPRTHESQAQDRVHSADVFHTFRQLDR
LLPKLARGSLSVGDKDHMCSVKSRLWKLLSPARLA
RRAHRSKWLESYLLHLEEMGVSEEMQARALVLQLW
ATQGNMGPAAFWLLLFLLKNPEALAAVRGELESIL
WQAEQ
Storage
-20C
Provider Type Product Number
- No reagents -