Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00079228-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00079228-M01, RRID:AB_530228
- Product name
- WDR58 monoclonal antibody (M01), clone 1F6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant WDR58.
- Antigen sequence
TFQAHDGPVYSMVSTDRHLLSAGDGEVKAWLWAEM
LKKGCKELWRRQPPYRTSLEVPEINALLLVPKENS
LILAGGDCQLHTMDLETGTFTRVLRGHTDYIHCLA
LRERS- Isotype
- IgG
- Antibody clone number
- 1F6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Human TREX component Thoc5 affects alternative polyadenylation site choice by recruiting mammalian cleavage factor I.
Adaptor Aly and co-adaptor Thoc5 function in the Tap-p15-mediated nuclear export of HSP70 mRNA.
Katahira J, Okuzaki D, Inoue H, Yoneda Y, Maehara K, Ohkawa Y
Nucleic acids research 2013 Aug;41(14):7060-72
Nucleic acids research 2013 Aug;41(14):7060-72
Adaptor Aly and co-adaptor Thoc5 function in the Tap-p15-mediated nuclear export of HSP70 mRNA.
Katahira J, Inoue H, Hurt E, Yoneda Y
The EMBO journal 2009 Mar 4;28(5):556-67
The EMBO journal 2009 Mar 4;28(5):556-67
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- WDR58 monoclonal antibody (M01), clone 1F6 Western Blot analysis of WDR58 expression in A-431 ( Cat # L015V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- WDR58 monoclonal antibody (M01), clone 1F6. Western Blot analysis of WDR58 expression in PC-12 ( Cat # L012V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of THOC6 expression in transfected 293T cell line by THOC6 monoclonal antibody (M01), clone 1F6.Lane 1: THOC6 transfected lysate (Predicted MW: 37.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged WDR58 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to WDR58 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol