WH0027288M1

RBMXL2 antibody from Sigma-Aldrich
HNRNPG-T, HNRPGT
ELISA
Recommended by provider
Immunocytochemistry
Recommended by provider
Immunohistochemistry
Recommended by provider

Antibody data

Product number
WH0027288M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0027288M1, RRID:AB_2179150
Product name
Monoclonal Anti-HNRNPG-T antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0027288M1
Antibody type
Monoclonal
Antigen
HNRNPG-T (NP_055284, a.a. 1-91) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse, Rat
Antigen sequence
MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIV
EVLLMKDRETNKSRGFAFVTFESPADAKAAARDMN
GKSLDGKAIKVAQATKPAFE* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -