Antibody data

Product number
H00027288-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027288-M01, RRID:AB_534898
Product name
HNRNPG-T monoclonal antibody (M01), clone 6F11
Provider product page
Abnova Corporation - H00027288-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant HNRNPG-T.
Antigen sequence
MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIV
EVLLMKDRETNKSRGFAFVTFESPADAKAAARDMN
GKSLDGKAIKVAQATKPAFE
Isotype
IgG
Antibody clone number
6F11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -