H00027288-A01

RBMXL2 antibody from Abnova Corporation
HNRNPG-T, HNRPGT
No application information provided.

Antibody data

Product number
H00027288-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027288-A01, RRID:AB_606396
Product name
HNRNPG-T polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00027288-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant HNRNPG-T.
Antigen sequence
MVEADRPGKLFIGGLNLETDEKALEAEFGKYGRIV
EVLLMKDRETNKSRGFAFVTFESPADAKAAARDMN
GKSLDGKAIKVAQATKPAFE
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -