H00001646-A01
antibody from Abnova Corporation
Targeting: AKR1C2
BABP, DD, DD2, DDH2, HAKRD, MCDR2, TDD
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001646-A01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001646-A01, RRID:AB_489333
- Product name
- AKR1C2 polyclonal antibody (A01)
- Antibody type
- Polyclonal
- Description
- Mouse polyclonal antibody raised against a partial recombinant AKR1C2.
- Antigen sequence
EEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALR
YQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEM
KAIDGLNRNVRYLTLDIFAGPPNYPVSDEY- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Aldo-keto reductase 1C2 is essential for 1-nitropyrene's but not for benzo[a]pyrene's induction of p53 phosphorylation and apoptosis.
Su JG, Liao PJ, Huang MC, Chu WC, Lin SC, Chang YJ
Toxicology 2008 Feb 28;244(2-3):257-70
Toxicology 2008 Feb 28;244(2-3):257-70
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- AKR1C2 polyclonal antibody (A01), Lot # CIL0060112QCS1 Western Blot analysis of AKR1C2 expression in HeLa ( Cat # L013V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of AKR1C2 expression in transfected 293T cell line by AKR1C2 polyclonal antibody (A01).Lane1:AKR1C2 transfected lysate(37 KDa).Lane2:Non-transfected lysate.