H00001646-M03

AKR1C2 antibody from Abnova Corporation
BABP, DD, DD2, DDH2, HAKRD, MCDR2, TDD

Antibody data

Product number
H00001646-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00001646-M03, RRID:AB_605919
Product name
AKR1C2 monoclonal antibody (M03), clone 3C11
Provider product page
Abnova Corporation - H00001646-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant AKR1C2.
Antigen sequence
EEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALR
YQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEM
KAIDGLNRNVRYLTLDIFAGPPNYPVSDEY
Isotype
IgG
Antibody clone number
3C11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.