HPA001323

EDDM3B antibody from Sigma-Aldrich
FAM12B, HE3-BETA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001323
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001323, RRID:AB_1848377
Product name
Anti-FAM12B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001323
Antibody type
Polyclonal
Antigen
Epididymal secretory protein E3 beta precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EVSWREFMKQHYLSPSREFREYKCDVLMRENEALK
DKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWV
QNPLKVLKCHQENSKNSYTESRSFNYIEFHCSMDG
YVDSIEDLKMVEPIGN
Storage
-20C
Provider Type Product Number
- No reagents -