HPA001097

ACO2 antibody from Atlas Antibodies
ACONM
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA001097
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA001097, RRID:AB_1078092
Product name
Anti-ACO2
Provider product page
Atlas Antibodies - HPA001097
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
GKKFRLEAPDADELPKGEFDPGQDTYQHPPKDSSG
QHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKV
KGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAIN
IENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWV
VIGDENYGEG
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -