Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN503915 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Aconitase 2, Mitochondrial (ACO2) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACO2 antibody: synthetic peptide directed towards the N terminal of human ACO2
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Xenopus
- Host
- Rabbit
- Antigen sequence
LQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRR
AKDIN QEVYNFLATA- Vial size
- 50 µg
Submitted references Proteomic profiling and pathway analysis of the response of rat renal proximal convoluted tubules to metabolic acidosis.
Response of the mitochondrial proteome of rat renal proximal convoluted tubules to chronic metabolic acidosis.
Characterization of the mitochondrial aconitase promoter and the identification of transcription factor binding.
Schauer KL, Freund DM, Prenni JE, Curthoys NP
American journal of physiology. Renal physiology 2013 Sep 1;305(5):F628-40
American journal of physiology. Renal physiology 2013 Sep 1;305(5):F628-40
Response of the mitochondrial proteome of rat renal proximal convoluted tubules to chronic metabolic acidosis.
Freund DM, Prenni JE, Curthoys NP
American journal of physiology. Renal physiology 2013 Jan 15;304(2):F145-55
American journal of physiology. Renal physiology 2013 Jan 15;304(2):F145-55
Characterization of the mitochondrial aconitase promoter and the identification of transcription factor binding.
Yu Z, Costello LC, Feng P, Franklin RB
The Prostate 2006 Jul 1;66(10):1061-9
The Prostate 2006 Jul 1;66(10):1061-9
No comments: Submit comment
No validations: Submit validation data