HPA001097

ACO2 antibody from Sigma-Aldrich
ACONM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001097
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001097, RRID:AB_1078092
Product name
Anti-ACO2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001097
Antibody type
Polyclonal
Antigen
Aconitate hydratase, mitochondrial precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GKKFRLEAPDADELPKGEFDPGQDTYQHPPKDSSG
QHVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKV
KGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAIN
IENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWV
VIGDENYGEG
Storage
-20C
Provider Type Product Number
- No reagents -