Antibody data

Product number
PAB27470
Provider
Abnova Corporation
Product name
CDH26 polyclonal antibody
Provider product page
Abnova Corporation - PAB27470
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant CDH26.
Antigen sequence
VIIIHAVDDGFPPQTATGTLMLFLSDINDNVPTLR
PRSRYMEVCESAVHEPLHIEAEDPDLEPFSDPFTF
ELDNTWGNAEDTWKLGRNWGQSVELLTLRSLPRGN
YLVPLFIGDKQGLSQKQTVHVRICPCASGLTCVEL
ADAEVGL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -