Antibody data

Product number
H00060437-M04
Provider
Abnova Corporation
Product name
CDH26 monoclonal antibody (M04), clone 6C10
Provider product page
Abnova Corporation - H00060437-M04
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CDH26.
Antigen sequence
MKPLIWTWSDVEGQRPALLICTAAAGPTQGVKDLE
EVPPSAASQSAQARCALGSWGYGKPFEPRSVKNIH
STPAYPDATMHRQLLAPVEGRMAETLNQKLHVANV
LEDDPGYLPHVYSEEGECGGAPSLSSLASLEQELQ
PDLLDSLGSKATPFEEIYSESGVPS
Isotype
IgG
Antibody clone number
6C10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -