WH0057213M1

SPRYD7 antibody from Sigma-Aldrich
C13orf1, CLLD6
ELISA
Recommended by provider

Antibody data

Product number
WH0057213M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0057213M1, RRID:AB_1840368
Product name
Monoclonal Anti-C13orf1 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0057213M1
Antibody type
Monoclonal
Antigen
C13orf1 (NP_065189, a.a. 97-197) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human, Mouse, Rat
Antigen sequence
MHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVG
ITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYVD
DSAILDCQFSEFYHTPPPGFEKILFEQQIF* (wi
thout GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -