Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406204 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Adaptor-Related Protein Complex 3, mu 2 Subunit (AP3M2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-AP3M2 antibody: synthetic peptide directed towards the middle region of human AP3M2
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
VVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNN
EAYFD VIEEIDAIID- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Pedicle screw fixation of the cervical spine: guidance by computed tomography.
Mutation screening of AP3M2 in Japanese epilepsy patients.
Su P, Ma R, Li C, Liu S, Huang D
Clinical orthopaedics and related research 2007 Sep;462:99-104
Clinical orthopaedics and related research 2007 Sep;462:99-104
Mutation screening of AP3M2 in Japanese epilepsy patients.
Huang MC, Okada M, Nakatsu F, Oguni H, Ito M, Morita K, Nagafuji H, Hirose S, Sakaki Y, Kaneko S, Ohno H, Kojima T
Brain & development 2007 Sep;29(8):462-7
Brain & development 2007 Sep;29(8):462-7
No comments: Submit comment
No validations: Submit validation data